PLAT anticorps (Middle Region)

N° du produit ABIN632631

Détail du produit anti-PLAT anticorps

Antigène: PLAT (Plasminogen Activator, Tissue (PLAT))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLAT est non-conjugé

Application: Western Blotting (WB)

Specificité: PLAT antibody was raised against the middle region of PLAT

Purification: Affinity purified

Immunogène: PLAT antibody was raised using the middle region of PLAT corresponding to a region with amino acids TVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLAT Blocking Peptide, catalog no. 33R-9356, is also available for use as a blocking control in assays to test for specificity of this PLAT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLAT

Antigène: PLAT (Plasminogen Activator, Tissue (PLAT))

Autre désignation: PLAT (PLAT Produits)

Synonymes: anticorps T-PA, anticorps TPA, anticorps AU020998, anticorps AW212668, anticorps D8Ertd2e, anticorps tPA, anticorps PATISS, anticorps tpa, anticorps Plat, anticorps plat, anticorps t-pa, anticorps plasminogen activator, tissue type, anticorps plasminogen activator, tissue, anticorps chromosome 20 open reading frame 181, anticorps plasminogen activator, tissue L homeolog, anticorps PLAT, anticorps Plat, anticorps plat, anticorps C20orf181, anticorps plat.L

Sujet: This gene encodes tissue-type plasminogen activator, a secreted serine protease which converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. Tissue-type plasminogen activator is synthesized as a single chain which is cleaved by plasmin to a two chain disulfide linked protein. This enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding, decreased activity leads to hypofibrinolysis which can result in thrombosis or embolism. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: Autophagy, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling, SARS-CoV-2 Protein Interactome