PLAT anticorps (Middle Region)

N° du produit ABIN632631

Cet anticorps anti-PLAT Polyclonal Lapin (ABIN632631) détecte spécifiquement PLAT dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour PLAT anticorps (Middle Region) (ABIN632631)

Antigène: PLAT (Plasminogen Activator, Tissue (PLAT))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLAT est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PLAT anticorps

Épitope: Middle Region

Specificité: PLAT antibody was raised against the middle region of PLAT

Purification: Affinity purified

Immunogène: PLAT antibody was raised using the middle region of PLAT corresponding to a region with amino acids TVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLAT Blocking Peptide, (ABIN5615407), is also available for use as a blocking control in assays to test for specificity of this PLAT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLAT

Antigène: PLAT (Plasminogen Activator, Tissue (PLAT))

Autre désignation: PLAT

Sujet: This gene encodes tissue-type plasminogen activator, a secreted serine protease which converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. Tissue-type plasminogen activator is synthesized as a single chain which is cleaved by plasmin to a two chain disulfide linked protein. This enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding, decreased activity leads to hypofibrinolysis which can result in thrombosis or embolism. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: Autophagy, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling, SARS-CoV-2 Protein Interactome