PHLDA3 anticorps (N-Term)

N° du produit ABIN632801

L’anticorps Lapin Polyclonal anti-PHLDA3 a été validé pour WB. Il convient pour détecter PHLDA3 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PHLDA3 anticorps (N-Term) (ABIN632801)

Antigène: PHLDA3 (Pleckstrin Homology-Like Domain, Family A, Member 3 (PHLDA3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PHLDA3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PHLDA3 anticorps

Épitope: N-Term

Specificité: PHLDA3 antibody was raised against the N terminal of PHLDA3

Purification: Affinity purified

Immunogène: PHLDA3 antibody was raised using the N terminal of PHLDA3 corresponding to a region with amino acids LQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PHLDA3 Blocking Peptide, (ABIN5615352), is also available for use as a blocking control in assays to test for specificity of this PHLDA3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHLDA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PHLDA3

Antigène: PHLDA3 (Pleckstrin Homology-Like Domain, Family A, Member 3 (PHLDA3))

Autre désignation: PHLDA3

Sujet: PHLDA3 is a p53/TP53-regulated repressor of Akt/AKT1 signaling. It represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity.

Poids moléculaire: 14 kDa (MW of target protein)