PSPH anticorps (Middle Region)

N° du produit ABIN632903

L’anticorps anti-PSPH Polyclonal Lapin est utilisé pour la détection de PSPH dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour PSPH anticorps (Middle Region) (ABIN632903)

Antigène: PSPH (Phosphoserine Phosphatase (PSPH))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSPH est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PSPH anticorps

Épitope: Middle Region

Specificité: PSPH antibody was raised against the middle region of PSPH

Purification: Affinity purified

Immunogène: PSPH antibody was raised using the middle region of PSPH corresponding to a region with amino acids IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSPH Blocking Peptide, (ABIN939453), is also available for use as a blocking control in assays to test for specificity of this PSPH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSPH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSPH

Antigène: PSPH (Phosphoserine Phosphatase (PSPH))

Autre désignation: PSPH

Sujet: The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: L'effet Warburg