RAGE anticorps (N-Term)

N° du produit ABIN632910

Cet anticorps anti-RAGE Polyclonal Lapin (ABIN632910) détecte spécifiquement RAGE dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour RAGE anticorps (N-Term) (ABIN632910)

Antigène: RAGE (AGER) (Advanced Glycosylation End Product-Specific Receptor (AGER))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAGE est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RAGE anticorps

Épitope: N-Term

Specificité: RAGE antibody was raised against the N terminal of RAGE

Purification: Affinity purified

Immunogène: RAGE antibody was raised using the N terminal of RAGE corresponding to a region with amino acids MKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAGE Blocking Peptide, (ABIN5615742), is also available for use as a blocking control in assays to test for specificity of this RAGE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAGE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAGE

Antigène: RAGE (AGER) (Advanced Glycosylation End Product-Specific Receptor (AGER))

Autre désignation: RAGE

Sujet: RAGE is able to phosphorylate several exogenous substrates and to undergo autophosphorylation.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis, Toll-Like Receptors Cascades, Smooth Muscle Cell Migration, S100 Proteins