MAP7D1 anticorps (N-Term)

N° du produit ABIN632935

Cet anticorps Lapin Polyclonal détecte spécifiquement MAP7D1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour MAP7D1 anticorps (N-Term) (ABIN632935)

Antigène: MAP7D1 (MAP7 Domain Containing 1 (MAP7D1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAP7D1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MAP7D1 anticorps

Épitope: N-Term

Specificité: MAP7 D1 antibody was raised against the N terminal of MAP7 1

Purification: Affinity purified

Immunogène: MAP7 D1 antibody was raised using the N terminal of MAP7 1 corresponding to a region with amino acids RRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAP7D1 Blocking Peptide, (ABIN5614659), is also available for use as a blocking control in assays to test for specificity of this MAP7D1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAP7D1

Antigène: MAP7D1 (MAP7 Domain Containing 1 (MAP7D1))

Autre désignation: MAP7D1

Sujet: The function of MAP7 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 93 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome, Phosphorylation & l'infection par le SRAS-CoV-2