HSPA1L anticorps (C-Term)

N° du produit ABIN633004

Détail du produit anti-HSPA1L anticorps

Antigène: HSPA1L (Heat Shock 70kDa Protein 1-Like (HSPA1L))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSPA1L est non-conjugé

Application: Western Blotting (WB)

Specificité: HSPA1 L antibody was raised against the C terminal of HSPA1

Purification: Affinity purified

Immunogène: HSPA1 L antibody was raised using the C terminal of HSPA1 corresponding to a region with amino acids DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSPA1L Blocking Peptide, catalog no. 33R-1900, is also available for use as a blocking control in assays to test for specificity of this HSPA1L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HSPA1L

Antigène: HSPA1L (Heat Shock 70kDa Protein 1-Like (HSPA1L))

Autre désignation: HSPA1L (HSPA1L Produits)

Synonymes: anticorps Hsc70t, anticorps Msh5, anticorps HSPA1L, anticorps hspa1l, anticorps MGC147483, anticorps Hsp70-3, anticorps HSP70-1L, anticorps HSP70-HOM, anticorps HSP70T, anticorps hum70t, anticorps heat shock 70kDa protein 1-like, anticorps heat shock protein 1-like, anticorps heat shock 70 kDa protein 1-like, anticorps heat shock protein family A (Hsp70) member 1 like, anticorps HSPA1L, anticorps Hspa1l, anticorps LOC471967, anticorps hspa1l, anticorps LOC474850, anticorps LOC102177850, anticorps LOC100050904

Sujet: HSPA1L is a 70 kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles.

Poids moléculaire: 70 kDa (MW of target protein)