HSPA1L anticorps (C-Term)

N° du produit ABIN633004

Cet anticorps Lapin Polyclonal détecte spécifiquement HSPA1L dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour HSPA1L anticorps (C-Term) (ABIN633004)

Antigène: HSPA1L (Heat Shock 70kDa Protein 1-Like (HSPA1L))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSPA1L est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HSPA1L anticorps

Épitope: C-Term

Specificité: HSPA1 L antibody was raised against the C terminal of HSPA1

Purification: Affinity purified

Immunogène: HSPA1 L antibody was raised using the C terminal of HSPA1 corresponding to a region with amino acids DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSPA1L Blocking Peptide, (ABIN937286), is also available for use as a blocking control in assays to test for specificity of this HSPA1L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HSPA1L

Antigène: HSPA1L (Heat Shock 70kDa Protein 1-Like (HSPA1L))

Autre désignation: HSPA1L

Sujet: HSPA1L is a 70 kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles.

Poids moléculaire: 70 kDa (MW of target protein)