POLI anticorps

N° du produit ABIN633154

Cet anticorps Lapin Polyclonal détecte spécifiquement POLI dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour POLI anticorps (ABIN633154)

Antigène: POLI (Polymerase (DNA Directed) iota (POLI))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POLI est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-POLI anticorps

Purification: Affinity purified

Immunogène: POLI antibody was raised using a synthetic peptide corresponding to a region with amino acids PVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POLI Blocking Peptide, (ABIN5615457), is also available for use as a blocking control in assays to test for specificity of this POLI antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLI antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POLI

Antigène: POLI (Polymerase (DNA Directed) iota (POLI))

Autre désignation: POLI

Sujet: POLI is an error-prone DNA polymerase specifically involved in DNA repair.POLI plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. POLI favors Hoogsteen base-pairing in the active site.POLI inserts the correct base with high-fidelity opposite an adenosine template.

Poids moléculaire: 83 kDa (MW of target protein)

Pathways: Réparation de l'ADN