RAE1 anticorps
-
- Antigène Voir toutes RAE1 Anticorps
- RAE1 (RAE1 RNA Export 1 Homolog (S. Pombe) (RAE1))
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RAE1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogène
- RAE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEE
- Top Product
- Discover our top product RAE1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RAE1 Blocking Peptide, catalog no. 33R-2670, is also available for use as a blocking control in assays to test for specificity of this RAE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RAE1 (RAE1 RNA Export 1 Homolog (S. Pombe) (RAE1))
- Autre désignation
- RAE1 (RAE1 Produits)
- Synonymes
- anticorps gle2, anticorps mig14, anticorps mnrp41, anticorps mrnp41, anticorps MRNP41, anticorps zgc:56449, anticorps zgc:77723, anticorps 3230401I12Rik, anticorps 41, anticorps D2Ertd342e, anticorps MNRP, anticorps MNRP41, anticorps MIG14, anticorps Mnrp41, anticorps dJ481F12.3, anticorps dJ800J21.1, anticorps ribonucleic acid export 1, anticorps RAE1 RNA export 1 homolog, anticorps ribonucleic acid export 1 L homeolog, anticorps rae1, anticorps LOC664096, anticorps RAE1, anticorps rae1.L, anticorps Rae1
- Sujet
- RAE1 is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.
- Poids moléculaire
- 40 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-