EIF4E anticorps (C-Term)

N° du produit ABIN633255

Cet anticorps anti-EIF4E est un anticorps Lapin Polyclonal détectant EIF4E dans WB. Adapté pour Humain, Rat et Souris.

Aperçu rapide pour EIF4E anticorps (C-Term) (ABIN633255)

Antigène: EIF4E (Eukaryotic Translation Initiation Factor 4E (EIF4E))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF4E est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EIF4E anticorps

Épitope: C-Term

Specificité: EIF4 E antibody was raised against the C terminal of EIF4

Purification: Affinity purified

Immunogène: EIF4 E antibody was raised using the C terminal of EIF4 corresponding to a region with amino acids TECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF4E Blocking Peptide, (ABIN5613341), is also available for use as a blocking control in assays to test for specificity of this EIF4E antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF4E

Antigène: EIF4E (Eukaryotic Translation Initiation Factor 4E (EIF4E))

Autre désignation: EIF4E

Sujet: All eukaryotic cellular mRNAs are blocked at their 5-prime ends with the 7-methylguanosine cap structure, m7GpppX (where X is any nucleotide). This structure is involved in several cellular processes including enhanced translational efficiency, splicing, mRNA stability, and RNA nuclear export.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: BCR Signaling