EIF4E anticorps (C-Term)

N° du produit ABIN633255

Détail du produit anti-EIF4E anticorps

Antigène: EIF4E (Eukaryotic Translation Initiation Factor 4E (EIF4E))

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF4E est non-conjugé

Application: Western Blotting (WB)

Specificité: EIF4 E antibody was raised against the C terminal of EIF4

Purification: Affinity purified

Immunogène: EIF4 E antibody was raised using the C terminal of EIF4 corresponding to a region with amino acids TECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF4E Blocking Peptide, catalog no. 33R-9028, is also available for use as a blocking control in assays to test for specificity of this EIF4E antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF4E

Antigène: EIF4E (Eukaryotic Translation Initiation Factor 4E (EIF4E))

Autre désignation: EIF4E (EIF4E Produits)

Synonymes: anticorps AUTS19, anticorps CBP, anticorps EIF4E1, anticorps EIF4EL1, anticorps EIF4F, anticorps eif4e-1, anticorps zgc:86680, anticorps EG668879, anticorps Eif4e-ps, anticorps If4e, anticorps eIF-4E, anticorps 0260/09, anticorps 0587/11, anticorps 0589/11, anticorps 0919/12, anticorps 1004/13, anticorps 2, anticorps 7238, anticorps CG4035, anticorps CT13384, anticorps CT39424, anticorps CT39426, anticorps D-eIF4E, anticorps Dmel\\CG4035, anticorps Eif4E, anticorps Eif4e, anticorps IF4E, anticorps dEif4e, anticorps deIF-4E, anticorps deIF4E, anticorps eIF 4E, anticorps eIF-4E1, anticorps eIF-4E2, anticorps eIF-4EII, anticorps eIF-4e, anticorps eIF4E, anticorps eIF4E-1, anticorps eIF4E-1/2, anticorps eIF4E-2, anticorps eIF4E1, anticorps eIF4EI, anticorps eIF4e, anticorps eif-4E, anticorps eif-4e, anticorps eif4e, anticorps l(3)07238, anticorps l(3)67Af, anticorps l(3)S025007, anticorps l(3)S026009, anticorps l(3)S058711, anticorps l(3)S091912, anticorps cbp, anticorps eif4f, anticorps eif4e1, anticorps eif4el1, anticorps EIF-4E, anticorps zgc:101581, anticorps eukaryotic translation initiation factor 4E, anticorps eukaryotic translation initiation factor 4ea, anticorps Eukaryotic initiation factor 4E, anticorps eucaryotic initiation factor 6, anticorps eukaryotic translation initiation factor 4E L homeolog, anticorps eukaryotic translation initiation factor 4E family member 1B S homeolog, anticorps translation initiation factor eIF4E, anticorps eukaryotic translation initiation factor 4eb, anticorps EIF4E, anticorps eif4ea, anticorps Eif4e, anticorps eIF-4E, anticorps eif6, anticorps eif4e, anticorps eif4e.L, anticorps eif4e1b.S, anticorps LOC100533326, anticorps eif4eb

Sujet: All eukaryotic cellular mRNAs are blocked at their 5-prime ends with the 7-methylguanosine cap structure, m7GpppX (where X is any nucleotide). This structure is involved in several cellular processes including enhanced translational efficiency, splicing, mRNA stability, and RNA nuclear export.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: BCR Signaling