A1CF anticorps (N-Term)

N° du produit ABIN633343

Cet anticorps Lapin Polyclonal détecte spécifiquement A1CF dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour A1CF anticorps (N-Term) (ABIN633343)

Antigène: A1CF (APOBEC1 Complementation Factor (A1CF))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp A1CF est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-A1CF anticorps

Épitope: N-Term

Specificité: A1 CF antibody was raised against the N terminal of A1 F

Purification: Affinity purified

Immunogène: A1 CF antibody was raised using the N terminal of A1 F corresponding to a region with amino acids MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

A1CF Blocking Peptide, (ABIN5611834), is also available for use as a blocking control in assays to test for specificity of this A1CF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 F antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur A1CF

Antigène: A1CF (APOBEC1 Complementation Factor (A1CF))

Autre désignation: A1CF

Sujet: Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene.

Poids moléculaire: 64 kDa (MW of target protein)