CPEB2 anticorps (N-Term)

N° du produit ABIN633424

Cet anticorps Lapin Polyclonal détecte spécifiquement CPEB2 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour CPEB2 anticorps (N-Term) (ABIN633424)

Antigène: CPEB2 (Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPEB2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CPEB2 anticorps

Épitope: N-Term

Specificité: CPEB2 antibody was raised against the N terminal of CPEB2

Purification: Affinity purified

Immunogène: CPEB2 antibody was raised using the N terminal of CPEB2 corresponding to a region with amino acids FLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMG

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CPEB2 Blocking Peptide, (ABIN938364), is also available for use as a blocking control in assays to test for specificity of this CPEB2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPEB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CPEB2

Antigène: CPEB2 (Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2))

Autre désignation: CPEB2

Sujet: CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids.

Poids moléculaire: 65 kDa (MW of target protein)