GIPC1 anticorps (N-Term)

N° du produit ABIN633430

Cet anticorps Lapin Polyclonal détecte spécifiquement GIPC1 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris, Rat, Poisson zèbre (Danio rerio) et Chien.

Aperçu rapide pour GIPC1 anticorps (N-Term) (ABIN633430)

Antigène: GIPC1 (GIPC PDZ Domain Containing Family, Member 1 (GIPC1))

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GIPC1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GIPC1 anticorps

Épitope: N-Term

Specificité: GIPC1 antibody was raised against the N terminal of GIPC1

Purification: Affinity purified

Immunogène: GIPC1 antibody was raised using the N terminal of GIPC1 corresponding to a region with amino acids SGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GIPC1 Blocking Peptide, (ABIN5613765), is also available for use as a blocking control in assays to test for specificity of this GIPC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GIPC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GIPC1

Antigène: GIPC1 (GIPC PDZ Domain Containing Family, Member 1 (GIPC1))

Autre désignation: GIPC1

Sujet: GIPC1 belongs to the GIPC family. It may be involved in G protein-linked signaling.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport