ACCN1 anticorps

N° du produit ABIN633672

Cet anticorps anti-ACCN1 est un anticorps Lapin Polyclonal détectant ACCN1 dans WB. Adapté pour Humain, Rat et Souris.

Aperçu rapide pour ACCN1 anticorps (ABIN633672)

Antigène: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACCN1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ACCN1 anticorps

Purification: Affinity purified

Immunogène: ACCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLDLLGKEEDEGSHDENVSTCDTMPNHSETISHTVNVPLQTTLGTLEEIA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACCN1 Blocking Peptide, (ABIN940510), is also available for use as a blocking control in assays to test for specificity of this ACCN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACCN1

Antigène: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Autre désignation: ACCN1

Sujet: ACCN1 is a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing.

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Sensory Perception of Sound