ACCN1 anticorps

N° du produit ABIN633672

Détail du produit anti-ACCN1 anticorps

Antigène: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACCN1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ACCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLDLLGKEEDEGSHDENVSTCDTMPNHSETISHTVNVPLQTTLGTLEEIA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACCN1 Blocking Peptide, catalog no. 33R-5124, is also available for use as a blocking control in assays to test for specificity of this ACCN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACCN1

Antigène: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Autre désignation: ACCN1 (ACCN1 Produits)

Synonymes: anticorps ACCN, anticorps ACCN1, anticorps ASIC2a, anticorps BNC1, anticorps BNaC1, anticorps MDEG, anticorps hBNaC1, anticorps ACIC2, anticorps Accn1, anticorps BNaC1a, anticorps Mdeg, anticorps BNC1k, anticorps MDEG1, anticorps MDEG2, anticorps accn1, anticorps zASIC2, anticorps acid sensing ion channel subunit 2, anticorps acid-sensing (proton-gated) ion channel 2, anticorps ASIC2, anticorps Asic2, anticorps asic2

Sujet: ACCN1 is a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing.

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Sensory Perception of Sound