Nestin anticorps (Middle Region)

N° du produit ABIN633803

Détail du produit anti-Nestin anticorps

Antigène: Nestin (NES)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Nestin est non-conjugé

Application: Western Blotting (WB)

Specificité: Nestin antibody was raised against the middle region of NES

Purification: Affinity purified

Immunogène: Nestin antibody was raised using the middle region of NES corresponding to a region with amino acids LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Nestin Blocking Peptide, catalog no. 33R-5261, is also available for use as a blocking control in assays to test for specificity of this Nestin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NES antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Nestin

Antigène: Nestin (NES)

Autre désignation: Nestin (NES Produits)

Synonymes: anticorps paranemin, anticorps NES, anticorps AA166324, anticorps C78523, anticorps ESTM46, anticorps nestin, anticorps nestin S homeolog, anticorps NES, anticorps nes.S, anticorps Nes, anticorps nes

Sujet: Nestin is an intermediate filament protein. It is expressed predominantly in stem cells of the central nervous system in the neural tube.

Poids moléculaire: 177 kDa (MW of target protein)