UGCGL2 anticorps (N-Term)

N° du produit ABIN633912

Cet anticorps anti-UGCGL2 est un anticorps Lapin Polyclonal détectant UGCGL2 dans WB. Adapté pour Humain.

Aperçu rapide pour UGCGL2 anticorps (N-Term) (ABIN633912)

Antigène: UGCGL2 (UGT2) (UDP-Glucose Glycoprotein Glucosyltransferase 2 (UGT2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UGCGL2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UGCGL2 anticorps

Épitope: N-Term

Specificité: UGCGL2 antibody was raised against the N terminal of µgCGL2

Purification: Affinity purified

Immunogène: UGCGL2 antibody was raised using the N terminal of µgCGL2 corresponding to a region with amino acids KHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UGCGL2 Blocking Peptide, (ABIN939808), is also available for use as a blocking control in assays to test for specificity of this µgCGL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgCGL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UGCGL2

Antigène: UGCGL2 (UGT2) (UDP-Glucose Glycoprotein Glucosyltransferase 2 (UGT2))

Autre désignation: UGCGL2

Sujet: UGCGL2 recognises glycoproteins with minor folding defects. UGCGL2 reglucosylates single N-glycans near the misfolded part of the protein, thus providing quality control for protein folding in the endoplasmic reticulum. Reglucosylated proteins are recognised by calreticulin for recycling to the endoplasmic reticulum and refolding or degradation.

Poids moléculaire: 172 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome