RDH12 anticorps

N° du produit ABIN633966

Cet anticorps anti-RDH12 est un anticorps Polyclonal produit chez le Lapin, détectant RDH12 dans WB. Convient pour Humain.

Aperçu rapide pour RDH12 anticorps (ABIN633966)

Antigène: RDH12 (Retinol Dehydrogenase 12 (All-Trans/9-Cis/11-Cis) (RDH12))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RDH12 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RDH12 anticorps

Purification: Affinity purified

Immunogène: RDH12 antibody was raised using a synthetic peptide corresponding to a region with amino acids HIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RDH12 Blocking Peptide, (ABIN939140), is also available for use as a blocking control in assays to test for specificity of this RDH12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RDH12

Antigène: RDH12 (Retinol Dehydrogenase 12 (All-Trans/9-Cis/11-Cis) (RDH12))

Autre désignation: RDH12

Sujet: RDH12 is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. RDH12 also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3).

Poids moléculaire: 35 kDa (MW of target protein)