POLD2 anticorps

N° du produit ABIN634094

L’anticorps anti-POLD2 Polyclonal Lapin est utilisé pour la détection de POLD2 dans des échantillons de Humain, Rat et Souris. Il a été validé pour WB.

Aperçu rapide pour POLD2 anticorps (ABIN634094)

Antigène: POLD2 (Polymerase (DNA Directed), delta 2, Accessory Subunit (POLD2))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POLD2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-POLD2 anticorps

Purification: Affinity purified

Immunogène: POLD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POLD2 Blocking Peptide, (ABIN5615454), is also available for use as a blocking control in assays to test for specificity of this POLD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POLD2

Antigène: POLD2 (Polymerase (DNA Directed), delta 2, Accessory Subunit (POLD2))

Autre désignation: POLD2

Sujet: This protein is a DNA polymerase delta complex, it is involved in DNA replication and repair.

Poids moléculaire: 51 kDa (MW of target protein)

Pathways: Telomere Maintenance, Réparation de l'ADN, DNA Replication, Synthesis of DNA