RFC5 anticorps

N° du produit ABIN634103

Détail du produit anti-RFC5 anticorps

Antigène: RFC5 (Replication Factor C (Activator 1) 5, 36.5kDa (RFC5))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RFC5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: RFC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RFC5 Blocking Peptide, catalog no. 33R-5977, is also available for use as a blocking control in assays to test for specificity of this RFC5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RFC5

Antigène: RFC5 (Replication Factor C (Activator 1) 5, 36.5kDa (RFC5))

Autre désignation: RFC5 (RFC5 Produits)

Synonymes: anticorps zgc:110313, anticorps 2610020K06Rik, anticorps 2610209F07Rik, anticorps 36.5kDa, anticorps 36kDa, anticorps Recc5, anticorps RFC36, anticorps replication factor C (activator 1) 5, anticorps replication factor C subunit 5, anticorps replication factor C subunit 5 L homeolog, anticorps rfc5, anticorps Rfc5, anticorps RFC5, anticorps rfc5.L

Sujet: The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. RFC5 is the 36 kDa subunit. This subunit can interact with the C-terminal region of PCNA. It forms a core complex with the 38 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system.

Poids moléculaire: 38 kDa (MW of target protein)

Pathways: Telomere Maintenance, Réparation de l'ADN, DNA Replication, Synthesis of DNA