KIF22 anticorps (N-Term)

N° du produit ABIN634122

Détail du produit anti-KIF22 anticorps

Antigène: KIF22 (Kinesin Family Member 22 (KIF22))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIF22 est non-conjugé

Application: Western Blotting (WB)

Specificité: KIF22 antibody was raised against the N terminal of KIF22

Purification: Affinity purified

Immunogène: KIF22 antibody was raised using the N terminal of KIF22 corresponding to a region with amino acids CSLEIANWRNHQETLKYQFDAFYGERSTQQDIYAGSVQPILRHLLEGQNA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIF22 Blocking Peptide, catalog no. 33R-1809, is also available for use as a blocking control in assays to test for specificity of this KIF22 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIF22

Antigène: KIF22 (Kinesin Family Member 22 (KIF22))

Autre désignation: KIF22 (KIF22 Produits)

Synonymes: anticorps KIF22, anticorps T1E22.130, anticorps T1E22_130, anticorps DKFZp459I1739, anticorps A-328A3.2, anticorps KID, anticorps KNSL4, anticorps OBP, anticorps OBP-1, anticorps OBP-2, anticorps SEMDJL2, anticorps AU021460, anticorps C81217, anticorps Kid, anticorps Kif22a, anticorps zgc:171724, anticorps kid, anticorps kid-b, anticorps kif22-b, anticorps kiff22-b, anticorps kiff22b, anticorps knsl4, anticorps obp, anticorps obp-1, anticorps obp-2, anticorps kinesin family member 22, anticorps ATP binding microtubule motor family protein, anticorps KIF22, anticorps AT5G02370, anticorps Kif22, anticorps kif22, anticorps kif22-a

Sujet: KIF22 a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance.

Poids moléculaire: 73 kDa (MW of target protein)