NUP98 anticorps (N-Term)

N° du produit ABIN634181

Détail du produit anti-NUP98 anticorps

Antigène: NUP98 (Nucleoporin 98kDa (NUP98))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NUP98 est non-conjugé

Application: Western Blotting (WB)

Specificité: NUP98 antibody was raised against the N terminal of NUP98

Purification: Affinity purified

Immunogène: NUP98 antibody was raised using the N terminal of NUP98 corresponding to a region with amino acids EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NUP98 Blocking Peptide, catalog no. 33R-2374, is also available for use as a blocking control in assays to test for specificity of this NUP98 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP98 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NUP98

Antigène: NUP98 (Nucleoporin 98kDa (NUP98))

Autre désignation: NUP98 (NUP98 Produits)

Synonymes: anticorps CG10198, anticorps CG10201, anticorps Dmel\\CG10198, anticorps Nup 96, anticorps Nup 98, anticorps Nup-98, anticorps Nup96, anticorps Nup98, anticorps Nup98-Nup96, anticorps Nup98/96, anticorps l(3)95BCd, anticorps nup145, anticorps nup98-96, anticorps GB12688, anticorps NUP98, anticorps 4732457F17, anticorps AI849286, anticorps im:7151238, anticorps zgc:113968, anticorps zgc:63593, anticorps ADIR2, anticorps NUP196, anticorps NUP96, anticorps Nucleoporin 98-96kD, anticorps nuclear pore complex protein Nup98-Nup96, anticorps nucleoporin 98, anticorps nucleoporin 98kDa, anticorps nucleoporin 98 L homeolog, anticorps Nup98-96, anticorps LOC408335, anticorps NUP98, anticorps LOC587580, anticorps Nup98, anticorps nup98, anticorps nup98.L

Sujet: The nuclear pore complex (NPC) is comprised of approximately 50 unique proteins collectively known as nucleoporins. The 98 kDa nucleoporin is localized to the nucleoplasmic side of the NPC. Rat studies show that the 98 kDa nucleoporin functions as one of several docking site nucleoporins of transport substrates. The human gene has been shown to fuse to several genes following chromsome translocatons in acute myelogenous leukemia (AML) and T-cell acute lymphocytic leukemia (T-ALL).

Poids moléculaire: 98 kDa (MW of target protein)

Pathways: Stem Cell Maintenance, Protein targeting to Nucleus, SARS-CoV-2 Protein Interactome