Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

CDK1 anticorps (Middle Region)

CDK1 Reactivité: Humain, Souris, Rat, Drosophila melanogaster, Arabidopsis WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN634188
  • Antigène Voir toutes CDK1 Anticorps
    CDK1 (Cyclin-Dependent Kinase 1 (CDK1))
    Épitope
    • 36
    • 29
    • 26
    • 25
    • 18
    • 16
    • 14
    • 9
    • 8
    • 8
    • 8
    • 7
    • 6
    • 6
    • 5
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Middle Region
    Reactivité
    • 319
    • 180
    • 116
    • 39
    • 35
    • 31
    • 25
    • 20
    • 15
    • 14
    • 12
    • 11
    • 11
    • 9
    • 7
    • 6
    • 4
    • 4
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Humain, Souris, Rat, Drosophila melanogaster, Arabidopsis
    Hôte
    • 266
    • 63
    Lapin
    Clonalité
    • 255
    • 74
    Polyclonal
    Conjugué
    • 164
    • 27
    • 17
    • 15
    • 11
    • 10
    • 8
    • 8
    • 8
    • 8
    • 8
    • 8
    • 4
    • 4
    • 4
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    Cet anticorp CDK1 est non-conjugé
    Application
    • 262
    • 124
    • 67
    • 59
    • 54
    • 53
    • 53
    • 46
    • 45
    • 20
    • 20
    • 16
    • 6
    • 6
    • 4
    • 4
    • 4
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Specificité
    CDC2 antibody was raised against the middle region of CDC2
    Purification
    Affinity purified
    Immunogène
    CDC2 antibody was raised using the middle region of CDC2 corresponding to a region with amino acids CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF
    Top Product
    Discover our top product CDK1 Anticorps primaire
  • Indications d'application
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Commentaires

    CDC2 Blocking Peptide, catalog no. 33R-1643, is also available for use as a blocking control in assays to test for specificity of this CDC2 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC2 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Conseil sur la manipulation
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Antigène
    CDK1 (Cyclin-Dependent Kinase 1 (CDK1))
    Autre désignation
    CDC2 (CDK1 Produits)
    Synonymes
    anticorps CDC2, anticorps CDC28A, anticorps P34CDC2, anticorps Cdc2, anticorps Cdc2a, anticorps p34, anticorps cdc2, anticorps wu:fc30e01, anticorps zgc:92032, anticorps PSTAIR, anticorps cdc-2, anticorps cdc2-a, anticorps cdc28a, anticorps cdc2x1.1, anticorps p34cdc2, anticorps xcdc2, anticorps 5363, anticorps CDCDm, anticorps CDK1, anticorps CDK1/CDC2, anticorps CG5363, anticorps Cdk-1, anticorps Cdk1, anticorps Dcdc2, anticorps Dm cdc2, anticorps DmCdc2, anticorps DmCdk1, anticorps Dmcdc2, anticorps Dmel\\CG5363, anticorps cdc, anticorps cdc2Dm, anticorps cdk1, anticorps dCdk1, anticorps group 4, anticorps l(2)31Eh, anticorps CDC2A, anticorps CDC2AAT, anticorps CDK2, anticorps CDKA1, anticorps CDKA;1, anticorps CYCLIN-DEPENDENT KINASE A;1, anticorps cell division control 2, anticorps cdc2-b, anticorps cdc2a, anticorps cdc2x1.2, anticorps POL3, anticorps pold, anticorps cyclin dependent kinase 1, anticorps cyclin dependent kinase like 1, anticorps Cell division control protein 2 1, anticorps cyclin-dependent kinase 1, anticorps cyclin-dependent kinase 1 S homeolog, anticorps Cyclin-dependent kinase 1, anticorps cell division control 2, anticorps cell division control protein2 homolog, anticorps cyclin-dependent kinase 1 L homeolog, anticorps polymerase (DNA directed), delta 1, catalytic subunit L homeolog, anticorps cyclin-dependent protein kinase Cdk1/Cdc2, anticorps CDK1, anticorps CDKL1, anticorps POPTR_0004s14080g, anticorps Cdk1, anticorps cdk1, anticorps cdk1.S, anticorps CDC2, anticorps cdc2, anticorps cdk-1, anticorps cdk1.L, anticorps pold1.L
    Sujet
    The protein encoded by CDC2 is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control.
    Poids moléculaire
    34 kDa (MW of target protein)
    Pathways
    Cycle Cellulaire, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Activation of Innate immune Response, Mitotic G1-G1/S Phases, DNA Replication, M Phase, Toll-Like Receptors Cascades, Synthesis of DNA
Vous êtes ici:
Support technique