CDK1 anticorps (Middle Region)
-
- Antigène Voir toutes CDK1 Anticorps
- CDK1 (Cyclin-Dependent Kinase 1 (CDK1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Drosophila melanogaster, Arabidopsis
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CDK1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CDC2 antibody was raised against the middle region of CDC2
- Purification
- Affinity purified
- Immunogène
- CDC2 antibody was raised using the middle region of CDC2 corresponding to a region with amino acids CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF
- Top Product
- Discover our top product CDK1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CDC2 Blocking Peptide, catalog no. 33R-1643, is also available for use as a blocking control in assays to test for specificity of this CDC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CDK1 (Cyclin-Dependent Kinase 1 (CDK1))
- Autre désignation
- CDC2 (CDK1 Produits)
- Synonymes
-
anticorps CDC2, anticorps CDC28A, anticorps P34CDC2, anticorps Cdc2, anticorps Cdc2a, anticorps p34
, anticorps cdc2, anticorps wu:fc30e01, anticorps zgc:92032, anticorps PSTAIR, anticorps cdc-2, anticorps cdc2-a, anticorps cdc28a, anticorps cdc2x1.1, anticorps p34cdc2, anticorps xcdc2, anticorps 5363, anticorps CDCDm, anticorps CDK1, anticorps CDK1/CDC2, anticorps CG5363, anticorps Cdk-1, anticorps Cdk1, anticorps Dcdc2, anticorps Dm cdc2, anticorps DmCdc2, anticorps DmCdk1, anticorps Dmcdc2, anticorps Dmel\\CG5363, anticorps cdc, anticorps cdc2Dm, anticorps cdk1, anticorps dCdk1, anticorps group 4, anticorps l(2)31Eh, anticorps CDC2A, anticorps CDC2AAT, anticorps CDK2, anticorps CDKA1, anticorps CDKA;1, anticorps CYCLIN-DEPENDENT KINASE A;1, anticorps cell division control 2, anticorps cdc2-b, anticorps cdc2a, anticorps cdc2x1.2, anticorps POL3, anticorps pold, anticorps cyclin dependent kinase 1, anticorps cyclin dependent kinase like 1, anticorps Cell division control protein 2 1, anticorps cyclin-dependent kinase 1, anticorps cyclin-dependent kinase 1 S homeolog, anticorps Cyclin-dependent kinase 1, anticorps cell division control 2, anticorps cell division control protein2 homolog, anticorps cyclin-dependent kinase 1 L homeolog, anticorps polymerase (DNA directed), delta 1, catalytic subunit L homeolog, anticorps cyclin-dependent protein kinase Cdk1/Cdc2, anticorps CDK1, anticorps CDKL1, anticorps POPTR_0004s14080g, anticorps Cdk1, anticorps cdk1, anticorps cdk1.S, anticorps CDC2, anticorps cdc2, anticorps cdk-1, anticorps cdk1.L, anticorps pold1.L - Sujet
- The protein encoded by CDC2 is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control.
- Poids moléculaire
- 34 kDa (MW of target protein)
- Pathways
- Cycle Cellulaire, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Activation of Innate immune Response, Mitotic G1-G1/S Phases, DNA Replication, M Phase, Toll-Like Receptors Cascades, Synthesis of DNA
-