RNASEH2A anticorps (C-Term)

N° du produit ABIN634223

L’anticorps Lapin Polyclonal anti-RNASEH2A a été validé pour WB et IHC. Il convient pour détecter RNASEH2A dans des échantillons de Humain.

Aperçu rapide pour RNASEH2A anticorps (C-Term) (ABIN634223)

Antigène: RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNASEH2A est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-RNASEH2A anticorps

Épitope: C-Term

Specificité: RNASEH2 A antibody was raised against the C terminal of RNASEH2

Purification: Affinity purified

Immunogène: RNASEH2 A antibody was raised using the C terminal of RNASEH2 corresponding to a region with amino acids EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLES

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNASEH2A Blocking Peptide, (ABIN937886), is also available for use as a blocking control in assays to test for specificity of this RNASEH2A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASEH0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNASEH2A

Antigène: RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))

Autre désignation: RNASEH2A

Sujet: Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.

Poids moléculaire: 33 kDa (MW of target protein)