JAG2 anticorps (N-Term)

N° du produit ABIN634269

Cet anticorps anti-JAG2 est un anticorps Lapin Polyclonal détectant JAG2 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour JAG2 anticorps (N-Term) (ABIN634269)

Antigène: JAG2 (Jagged 2 (JAG2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp JAG2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-JAG2 anticorps

Épitope: N-Term

Specificité: Jagged 2 antibody was raised against the N terminal of JAG2

Purification: Affinity purified

Immunogène: Jagged 2 antibody was raised using the N terminal of JAG2 corresponding to a region with amino acids RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Jagged 2 Blocking Peptide, (ABIN5614234), is also available for use as a blocking control in assays to test for specificity of this Jagged 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JAG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur JAG2

Antigène: JAG2 (Jagged 2 (JAG2))

Autre désignation: Jagged 2

Sujet: The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch protein family are transmembrane receptors that are critical for various cell fate decisions. JAG2 is one of several ligands that activate Notch and related receptors. The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions.

Poids moléculaire: 130 kDa (MW of target protein)

Pathways: Signalisation Notch, Sensory Perception of Sound