HGF anticorps
-
- Antigène Voir toutes HGF Anticorps
- HGF (Hepatocyte Growth Factor (Hepapoietin A, Scatter Factor) (HGF))
-
Reactivité
- Humain, Rat, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HGF est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- HGF antibody was raised using a synthetic peptide corresponding to a region with amino acids GESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDG
- Top Product
- Discover our top product HGF Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HGF Blocking Peptide, catalog no. 33R-3251, is also available for use as a blocking control in assays to test for specificity of this HGF antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HGF antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HGF (Hepatocyte Growth Factor (Hepapoietin A, Scatter Factor) (HGF))
- Autre désignation
- HGF (HGF Produits)
- Synonymes
- anticorps DFNB39, anticorps F-TCF, anticorps HGFB, anticorps HPTA, anticorps SF, anticorps HGF, anticorps C230052L06Rik, anticorps HGF/SF, anticorps NK1, anticorps NK2, anticorps SF/HGF, anticorps hepatocyte growth factor, anticorps HGF, anticorps Hgf
- Sujet
- Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration. It is secreted as a single inactive polypeptide and is cleaved by serine proteases into a 69 kDa alpha-chain and 34 kDa beta-chain. A disulfide bond between the alpha and beta chains produces the active, heterodimeric molecule. The protein belongs to the plasminogen subfamily of S1 peptidases but has no detectable protease activity.
- Poids moléculaire
- 26 kDa (MW of target protein)
- Pathways
- Signalisation RTK, Carbohydrate Homeostasis, Glycosaminoglycan Metabolic Process, Synaptic Membrane, Signaling of Hepatocyte Growth Factor Receptor
-