HGF anticorps

N° du produit ABIN634273

Cet anticorps Lapin Polyclonal détecte spécifiquement HGF dans WB. Il présente une réactivité avec des échantillons de Humain, Rat, Souris et Chien.

Aperçu rapide pour HGF anticorps (ABIN634273)

Antigène: HGF (Hepatocyte Growth Factor (Hepapoietin A, Scatter Factor) (HGF))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HGF est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HGF anticorps

Purification: Affinity purified

Immunogène: HGF antibody was raised using a synthetic peptide corresponding to a region with amino acids GESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HGF Blocking Peptide, (ABIN938637), is also available for use as a blocking control in assays to test for specificity of this HGF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HGF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HGF

Antigène: HGF (Hepatocyte Growth Factor (Hepapoietin A, Scatter Factor) (HGF))

Autre désignation: HGF

Sujet: Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration. It is secreted as a single inactive polypeptide and is cleaved by serine proteases into a 69 kDa alpha-chain and 34 kDa beta-chain. A disulfide bond between the alpha and beta chains produces the active, heterodimeric molecule. The protein belongs to the plasminogen subfamily of S1 peptidases but has no detectable protease activity.

Poids moléculaire: 26 kDa (MW of target protein)

Pathways: Signalisation RTK, Carbohydrate Homeostasis, Glycosaminoglycan Metabolic Process, Synaptic Membrane, Signaling of Hepatocyte Growth Factor Receptor