S100A9 anticorps (N-Term)

N° du produit ABIN634289

L’anticorps Lapin Polyclonal anti-S100A9 a été validé pour WB. Il convient pour détecter S100A9 dans des échantillons de Humain.

Aperçu rapide pour S100A9 anticorps (N-Term) (ABIN634289)

Antigène: S100A9 (S100 Calcium Binding Protein A9 (S100A9))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp S100A9 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-S100A9 anticorps

Épitope: N-Term

Specificité: S100 A9 antibody was raised against the N terminal of S100 9

Purification: Affinity purified

Immunogène: S100 A9 antibody was raised using the N terminal of S100 9 corresponding to a region with amino acids MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

S100A9 Blocking Peptide, (ABIN5615989), is also available for use as a blocking control in assays to test for specificity of this S100A9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of S100 9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur S100A9

Antigène: S100A9 (S100 Calcium Binding Protein A9 (S100A9))

Autre désignation: S100A9

Sujet: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells.

Poids moléculaire: 13 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Positive Regulation of Endopeptidase Activity, S100 Proteins