S100A9 anticorps (N-Term)

N° du produit ABIN634289

Détail du produit anti-S100A9 anticorps

Antigène: S100A9 (S100 Calcium Binding Protein A9 (S100A9))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp S100A9 est non-conjugé

Application: Western Blotting (WB)

Specificité: S100 A9 antibody was raised against the N terminal of S100 9

Purification: Affinity purified

Immunogène: S100 A9 antibody was raised using the N terminal of S100 9 corresponding to a region with amino acids MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

S100A9 Blocking Peptide, catalog no. 33R-6535, is also available for use as a blocking control in assays to test for specificity of this S100A9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of S100 9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur S100A9

Antigène: S100A9 (S100 Calcium Binding Protein A9 (S100A9))

Autre désignation: S100A9 (S100A9 Produits)

Synonymes: anticorps 60B8AG, anticorps CAGB, anticorps CFAG, anticorps CGLB, anticorps L1AG, anticorps LIAG, anticorps MAC387, anticorps MIF, anticorps MRP14, anticorps NIF, anticorps P14, anticorps Mrp14, anticorps S100A9, anticorps MRP-14, anticorps p14, anticorps 60B8Ag, anticorps AW546964, anticorps BEE22, anticorps Cagb, anticorps GAGB, anticorps L1Ag, anticorps S100 calcium binding protein A9, anticorps S100 calcium binding protein A9 (calgranulin B), anticorps S100A9, anticorps S100a9

Sujet: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells.

Poids moléculaire: 13 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Positive Regulation of Endopeptidase Activity, S100 Proteins