GRF2 anticorps

N° du produit ABIN634290

Cet anticorps anti-GRF2 est un anticorps Lapin Polyclonal détectant GRF2 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour GRF2 anticorps (ABIN634290)

Antigène: GRF2 (RAPGEF1) (Rap Guanine Nucleotide Exchange Factor (GEF) 1 (RAPGEF1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GRF2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GRF2 anticorps

Purification: Affinity purified

Immunogène: RAPGEF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAPGEF1 Blocking Peptide, (ABIN5615757), is also available for use as a blocking control in assays to test for specificity of this RAPGEF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAPGEF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GRF2

Antigène: GRF2 (RAPGEF1) (Rap Guanine Nucleotide Exchange Factor (GEF) 1 (RAPGEF1))

Autre désignation: RAPGEF1

Sujet: RAPGEF1 is a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade protein may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation.

Poids moléculaire: 120 kDa (MW of target protein)

Pathways: Interferon-gamma Pathway, Neurotrophin Signaling Pathway, Platelet-derived growth Factor Receptor Signaling, Signaling of Hepatocyte Growth Factor Receptor