TBK1 anticorps (N-Term)

N° du produit ABIN634305

Détail du produit anti-TBK1 anticorps

Antigène: TBK1 (TANK-Binding Kinase 1 (TBK1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TBK1 est non-conjugé

Application: Western Blotting (WB)

Specificité: TBK1 antibody was raised against the N terminal of TBK1

Purification: Affinity purified

Immunogène: TBK1 antibody was raised using the N terminal of TBK1 corresponding to a region with amino acids EEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TBK1 Blocking Peptide, catalog no. 33R-2352, is also available for use as a blocking control in assays to test for specificity of this TBK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TBK1

Antigène: TBK1 (TANK-Binding Kinase 1 (TBK1))

Autre désignation: TBK1 (TBK1 Produits)

Synonymes: anticorps nak, anticorps t2k, anticorps TBK1, anticorps wu:fk70c05, anticorps zgc:136548, anticorps NAK, anticorps T2K, anticorps 1200008B05Rik, anticorps AI462036, anticorps AW048562, anticorps TANK binding kinase 1 L homeolog, anticorps TANK binding kinase 1, anticorps TANK-binding kinase 1, anticorps tbk1.L, anticorps TBK1, anticorps tbk1, anticorps Tbk1

Sujet: The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation and nuclear translocation of the NFKB complex. TBK1 is similar to IKB kinases and can mediate NFKB activation in response to certain growth factors. For example, the protein can form a complex with the IKB protein TANK and TRAF2 and release the NFKB inhibition caused by TANK.

Poids moléculaire: 84 kDa (MW of target protein)

Pathways: Signalisation TLR, Activation of Innate immune Response, Hepatitis C, Toll-Like Receptors Cascades, SARS-CoV-2 Protein Interactome