SOD2 anticorps (N-Term)

N° du produit ABIN634322

Détail du produit anti-SOD2 anticorps

Antigène: SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SOD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: SOD2 antibody was raised against the N terminal of SOD2

Purification: Affinity purified

Immunogène: SOD2 antibody was raised using the N terminal of SOD2 corresponding to a region with amino acids MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SOD2 Blocking Peptide, catalog no. 33R-6219, is also available for use as a blocking control in assays to test for specificity of this SOD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SOD2

Antigène: SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))

Autre désignation: SOD2 (SOD2 Produits)

Synonymes: anticorps LOC100101896, anticorps MNSOD, anticorps GB14346, anticorps sod2, anticorps MGC88869, anticorps Sod2, anticorps CG8905, anticorps Dmel\\CG8905, anticorps Mito SOD, anticorps Mn SOD, anticorps Mn-SOD, anticorps Mn-SOD2, anticorps MnSOD, anticorps MnSODII, anticorps Mn[2+]SOD, anticorps SOD, anticorps SOD-2, anticorps SOD2, anticorps Sod-2, anticorps dSOD2, anticorps mitSOD2, anticorps mnSOD, anticorps IPOB, anticorps MVCD6, anticorps cb463, anticorps wu:fj33b01, anticorps zgc:73051, anticorps MnSOD, anticorps manganese superoxide dismutase, anticorps superoxide dismutase 2, mitochondrial, anticorps superoxide dismutase 2, anticorps Mn superoxide dismutase, anticorps Superoxide dismutase 2 (Mn), anticorps superoxide dismutase 2 L homeolog, anticorps BDBG_07234, anticorps LOC100101896, anticorps MNSOD, anticorps Sod2, anticorps sod2, anticorps LbMnSOD4, anticorps SOD2, anticorps LOC100282741, anticorps SOD-2, anticorps sod2.L

Sujet: SOD2 is a member of the iron/manganese superoxide dismutase family. SOD2 is a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene encoding SOD2 have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer.

Poids moléculaire: 24 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Transition Metal Ion Homeostasis, Negative Regulation of intrinsic apoptotic Signaling