RGS19 anticorps (N-Term)

N° du produit ABIN634327

Cet anticorps Lapin Polyclonal détecte spécifiquement RGS19 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour RGS19 anticorps (N-Term) (ABIN634327)

Antigène: RGS19 (Regulator of G-Protein Signalling 19 (RGS19))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RGS19 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RGS19 anticorps

Épitope: N-Term

Specificité: RGS19 antibody was raised against the N terminal of RGS19

Purification: Affinity purified

Immunogène: RGS19 antibody was raised using the N terminal of RGS19 corresponding to a region with amino acids PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RGS19 Blocking Peptide, (ABIN5615845), is also available for use as a blocking control in assays to test for specificity of this RGS19 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RGS19

Antigène: RGS19 (Regulator of G-Protein Signalling 19 (RGS19))

Autre désignation: RGS19

Sujet: G proteins mediate a number of cellular processes. RGS19 belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling.G proteins mediate a number of cellular processes.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling