STK38 anticorps (C-Term)

N° du produit ABIN634342

Cet anticorps Lapin Polyclonal détecte spécifiquement STK38 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour STK38 anticorps (C-Term) (ABIN634342)

Antigène: STK38 (serine/threonine Kinase 38 (STK38))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STK38 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-STK38 anticorps

Épitope: C-Term

Specificité: STK38 antibody was raised against the C terminal of STK38

Purification: Affinity purified

Immunogène: STK38 antibody was raised using the C terminal of STK38 corresponding to a region with amino acids IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STK38 Blocking Peptide, (ABIN939352), is also available for use as a blocking control in assays to test for specificity of this STK38 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STK38

Antigène: STK38 (serine/threonine Kinase 38 (STK38))

Autre désignation: STK38

Sujet: STK38 belongs to the protein kinase superfamily, AGC Ser/Thr protein kinase family. It contains 1 AGC-kinase C-terminal domain and 1 protein kinase domain. NDR-driven centrosome duplication requires Cdk2 activity and that Cdk2-induced centrosome amplification is affected upon reduction of NDR activity.

Poids moléculaire: 54 kDa (MW of target protein)