TBK1 anticorps (Middle Region)

N° du produit ABIN634411

Cet anticorps Lapin Polyclonal détecte spécifiquement TBK1 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour TBK1 anticorps (Middle Region) (ABIN634411)

Antigène: TBK1 (TANK-Binding Kinase 1 (TBK1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TBK1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TBK1 anticorps

Épitope: Middle Region

Specificité: TBK1 antibody was raised against the middle region of TBK1

Purification: Affinity purified

Immunogène: TBK1 antibody was raised using the middle region of TBK1 corresponding to a region with amino acids QEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TBK1 Blocking Peptide, (ABIN5616520), is also available for use as a blocking control in assays to test for specificity of this TBK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TBK1

Antigène: TBK1 (TANK-Binding Kinase 1 (TBK1))

Autre désignation: TBK1

Sujet: The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction.

Poids moléculaire: 84 kDa (MW of target protein)

Pathways: Signalisation TLR, Activation of Innate immune Response, Hepatitis C, Toll-Like Receptors Cascades, SARS-CoV-2 Protein Interactome