GZMA anticorps

N° du produit ABIN634499

Détail du produit anti-GZMA anticorps

Antigène: GZMA (Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3) (GZMA))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GZMA est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Granzyme A antibody was raised using a synthetic peptide corresponding to a region with amino acids TREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Granzyme A Blocking Peptide, catalog no. 33R-9256, is also available for use as a blocking control in assays to test for specificity of this Granzyme A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GZMA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GZMA

Antigène: GZMA (Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3) (GZMA))

Autre désignation: Granzyme A (GZMA Produits)

Synonymes: anticorps gzmA, anticorps GZMA, anticorps AW494114, anticorps Ctla-3, anticorps Ctla3, anticorps Hf, anticorps SE1, anticorps TSP-1, anticorps TSP1, anticorps CTLA3, anticorps HFSP, anticorps granzyme A, anticorps Granzyme A, anticorps granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3), anticorps gzmA, anticorps GZMA, anticorps graa, anticorps Gzma

Sujet: Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognise, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells.

Poids moléculaire: 26 kDa (MW of target protein)

Pathways: Apoptose