PRKAA1 anticorps (N-Term)

N° du produit ABIN634502

L’anticorps Lapin Polyclonal anti-PRKAA1 a été validé pour WB. Il convient pour détecter PRKAA1 dans des échantillons de Humain.

Aperçu rapide pour PRKAA1 anticorps (N-Term) (ABIN634502)

Antigène: PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit (PRKAA1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRKAA1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PRKAA1 anticorps

Épitope: N-Term

Specificité: PRKAA1 antibody was raised against the N terminal of PRKAA1

Purification: Affinity purified

Immunogène: PRKAA1 antibody was raised using the N terminal of PRKAA1 corresponding to a region with amino acids GELFDYICKNGRKSDVPGVVKTGSTKELDEKESRRLFQQILSGVDYCHRH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRKAA1 Blocking Peptide, (ABIN938621), is also available for use as a blocking control in assays to test for specificity of this PRKAA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKAA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRKAA1

Antigène: PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit (PRKAA1))

Autre désignation: PRKAA1

Sujet: PRKAA1 belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways.

Poids moléculaire: 62 kDa (MW of target protein)

Pathways: AMPK Signaling, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, L'effet Warburg