C1QB anticorps (C-Term)

N° du produit ABIN634558

Détail du produit anti-C1QB anticorps

Antigène: C1QB (Complement Component 1, Q Subcomponent, B Chain (C1QB))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C1QB est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: C1 QB antibody was raised against the C terminal of C1 B

Purification: Affinity purified

Immunogène: C1 QB antibody was raised using the C terminal of C1 B corresponding to a region with amino acids AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1QB Blocking Peptide, catalog no. 33R-1631, is also available for use as a blocking control in assays to test for specificity of this C1QB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 B antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C1QB

Antigène: C1QB (Complement Component 1, Q Subcomponent, B Chain (C1QB))

Autre désignation: C1QB (C1QB Produits)

Synonymes: anticorps complement C1q B chain, anticorps complement component 1, q subcomponent, beta polypeptide, anticorps C1QB, anticorps C1qb

Sujet: C1QB is a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. C1QB is the B-chain polypeptide of human complement subcomponent C1q.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Système du Complément