TAPBP anticorps

N° du produit ABIN634573

Détail du produit anti-TAPBP anticorps

Antigène: TAPBP (TAP Binding Protein (Tapasin) (TAPBP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TAPBP est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TAPBP antibody was raised using a synthetic peptide corresponding to a region with amino acids GKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TAPBP Blocking Peptide, catalog no. 33R-3361, is also available for use as a blocking control in assays to test for specificity of this TAPBP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TAPBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TAPBP

Antigène: TAPBP (TAP Binding Protein (Tapasin) (TAPBP))

Autre désignation: TAPBP (TAPBP Produits)

Synonymes: anticorps SI:dZ179B20.1, anticorps SI:dZ179B20.3, anticorps SI:dZ179B20.7, anticorps mhc1uda, anticorps mhc1ufa, anticorps tpsn, anticorps zgc:109814, anticorps tapbp, anticorps TAPBP, anticorps D17Wsu91e, anticorps TPN, anticorps NGS17, anticorps TAPA, anticorps TPSN, anticorps TAP binding protein (tapasin), tandem duplicate 1, anticorps TAP binding protein, anticorps tapbp.1, anticorps tapbp, anticorps TAPBP, anticorps Tapbp

Sujet: TAPBP is a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum.

Poids moléculaire: 30 kDa (MW of target protein)