AIF anticorps (C-Term)

N° du produit ABIN634586

L’anticorps anti-AIF Polyclonal Lapin est utilisé pour la détection de AIF dans des échantillons de Humain, Rat, Souris et Chien. Il a été validé pour WB.

Aperçu rapide pour AIF anticorps (C-Term) (ABIN634586)

Antigène: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AIF est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-AIF anticorps

Épitope: C-Term

Specificité: PDCD8 antibody was raised against the C terminal Of Pdcd8

Purification: Affinity purified

Immunogène: PDCD8 antibody was raised using the C terminal Of Pdcd8 corresponding to a region with amino acids VDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPST

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDCD8 Blocking Peptide, (ABIN5615270), is also available for use as a blocking control in assays to test for specificity of this PDCD8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDCD8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AIF

Antigène: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Autre désignation: PDCD8

Sujet: AIFM1 (PDCD8) is a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, AIFM1 induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Apoptose, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration, L'effet Warburg