AIF anticorps (C-Term)
-
- Antigène Voir toutes AIF (AIFM1) Anticorps
- AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AIF est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PDCD8 antibody was raised against the C terminal Of Pdcd8
- Purification
- Affinity purified
- Immunogène
- PDCD8 antibody was raised using the C terminal Of Pdcd8 corresponding to a region with amino acids VDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPST
- Top Product
- Discover our top product AIFM1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PDCD8 Blocking Peptide, catalog no. 33R-9480, is also available for use as a blocking control in assays to test for specificity of this PDCD8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDCD8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))
- Autre désignation
- PDCD8 (AIFM1 Produits)
- Synonymes
- anticorps AIF, anticorps CMTX4, anticorps COWCK, anticorps COXPD6, anticorps PDCD8, anticorps CG7263, anticorps DmAIF, anticorps Dmel\\CG7263, anticorps GB16024, anticorps DDBDRAFT_0187853, anticorps DDBDRAFT_0191137, anticorps DDB_0187853, anticorps DDB_0191137, anticorps aif, anticorps pdcd8, anticorps AIFM1, anticorps PCD8, anticorps AIFsh2, anticorps Hq, anticorps Pdcd8, anticorps mAIF, anticorps Aif, anticorps zgc:91994, anticorps apoptosis inducing factor mitochondria associated 1, anticorps allograft inflammatory factor 1, anticorps Apoptosis inducing factor, anticorps apoptosis-inducing factor 1, mitochondrial, anticorps apoptosis inducing factor, anticorps apoptosis inducing factor, mitochondria associated 1, anticorps apoptosis-inducing factor, mitochondrion-associated, 1, anticorps apoptosis-inducing factor, mitochondrion-associated 1, anticorps AIFM1, anticorps AIF1, anticorps AIF, anticorps LOC412212, anticorps aif, anticorps aifm1, anticorps Aifm1
- Sujet
- AIFM1 (PDCD8) is a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, AIFM1 induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9.
- Poids moléculaire
- 36 kDa (MW of target protein)
- Pathways
- Apoptose, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration, L'effet Warburg
-