Connexin 43/GJA1 anticorps (N-Term)

N° du produit ABIN634661

L’anticorps Lapin Polyclonal anti-Connexin 43/GJA1 a été validé pour WB. Il convient pour détecter Connexin 43/GJA1 dans des échantillons de Humain, Rat, Souris et Chien.

Aperçu rapide pour Connexin 43/GJA1 anticorps (N-Term) (ABIN634661)

Antigène: Connexin 43/GJA1 (GJA1) (Gap Junction Protein, alpha 1, 43kDa (GJA1))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Connexin 43/GJA1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Connexin 43/GJA1 anticorps

Épitope: N-Term

Specificité: GJA1 antibody was raised against the N terminal of GJA1

Purification: Affinity purified

Immunogène: GJA1 antibody was raised using the N terminal of GJA1 corresponding to a region with amino acids LYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVDMHLKQIEIKKFKYGIE

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GJA1 Blocking Peptide, (ABIN5613769), is also available for use as a blocking control in assays to test for specificity of this GJA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Connexin 43/GJA1

Antigène: Connexin 43/GJA1 (GJA1) (Gap Junction Protein, alpha 1, 43kDa (GJA1))

Autre désignation: GJA1

Sujet: Gap junction protein, alpha 1 is a member of the connexin gene family and a component of gap junctions. Gap junctions are composed of arrays of intercellular channels and provide a route for the diffusion of materials of low molecular weight from cell to cell. Connexin 43 is the major protein of gap junctions in the heart, and gap junctions are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Signalisation MAPK, Myometrial Relaxation and Contraction, Cell-Cell Junction Organization