MICA anticorps (N-Term)

N° du produit ABIN634664

L’anticorps Lapin Polyclonal anti-MICA a été validé pour WB. Il convient pour détecter MICA dans des échantillons de Humain.

Aperçu rapide pour MICA anticorps (N-Term) (ABIN634664)

Antigène: MICA (MHC Class I Polypeptide-Related Sequence A (MICA))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MICA est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MICA anticorps

Épitope: N-Term

Specificité: MICA antibody was raised against the N terminal of MICA

Purification: Affinity purified

Immunogène: MICA antibody was raised using the N terminal of MICA corresponding to a region with amino acids LHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MICA Blocking Peptide, (ABIN940415), is also available for use as a blocking control in assays to test for specificity of this MICA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MICA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MICA

Antigène: MICA (MHC Class I Polypeptide-Related Sequence A (MICA))

Autre désignation: MICA

Sujet: MICA is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognised by intestinal epithelial gamma delta T cells.

Poids moléculaire: 43 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Transition Metal Ion Homeostasis, Human Leukocyte Antigen (HLA) in Adaptive Immune Response