DLL1 anticorps

N° du produit ABIN634696

Cet anticorps Lapin Polyclonal détecte spécifiquement DLL1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour DLL1 anticorps (ABIN634696)

Antigène: DLL1 (delta-Like 1 (DLL1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DLL1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DLL1 anticorps

Purification: Affinity purified

Immunogène: DLL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DLL1 Blocking Peptide, (ABIN938966), is also available for use as a blocking control in assays to test for specificity of this DLL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DLL1

Antigène: DLL1 (delta-Like 1 (DLL1))

Autre désignation: DLL1

Sujet: DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.

Poids moléculaire: 78 kDa (MW of target protein)

Pathways: Signalisation Notch, Stem Cell Maintenance