Cadherin-16 anticorps (N-Term)

N° du produit ABIN634728

Détail du produit anti-Cadherin-16 anticorps

Antigène: Cadherin-16 (CDH16)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cadherin-16 est non-conjugé

Application: Western Blotting (WB)

Specificité: CDH16 antibody was raised against the N terminal of CDH16

Purification: Affinity purified

Immunogène: CDH16 antibody was raised using the N terminal of CDH16 corresponding to a region with amino acids SDRDEPGTANSDLRFHILSQAPAQPSPDMFQLEPRLGALALSPKGSTSLD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDH16 Blocking Peptide, catalog no. 33R-8368, is also available for use as a blocking control in assays to test for specificity of this CDH16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cadherin-16

Antigène: Cadherin-16 (CDH16)

Autre désignation: CDH16 (CDH16 Produits)

Synonymes: anticorps cadherin 16, anticorps CDH16, anticorps Cdh16

Sujet: CDH16 is a member of the cadherin superfamily, which are calcium-dependent, membrane-associated glycoproteins. CDH16 consists of an extracellular domain containing 6 cadherin domains, a transmembrane region and a truncated cytoplasmic domain but lacks the prosequence and tripeptide HAV adhesion recognition sequence typical of most classical cadherins. Expression is exclusively in kidney, where the protein functions as the principal mediator of homotypic cellular recognition, playing a role in the morphogenic direction of tissue development.

Poids moléculaire: 88 kDa (MW of target protein)