Claudin 7 anticorps (Middle Region)

N° du produit ABIN634729

Cet anticorps Lapin Polyclonal détecte spécifiquement Claudin 7 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour Claudin 7 anticorps (Middle Region) (ABIN634729)

Antigène: Claudin 7 (CLDN7)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Claudin 7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Claudin 7 anticorps

Épitope: Middle Region

Specificité: Claudin 7 antibody was raised against the middle region of CLDN7

Purification: Affinity purified

Immunogène: Claudin 7 antibody was raised using the middle region of CLDN7 corresponding to a region with amino acids GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Claudin 7 Blocking Peptide, (ABIN938852), is also available for use as a blocking control in assays to test for specificity of this Claudin 7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Claudin 7

Antigène: Claudin 7 (CLDN7)

Autre désignation: Claudin 7

Sujet: Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Hepatitis C