Mesothelin anticorps (Middle Region)

N° du produit ABIN634759

Cet anticorps Lapin Polyclonal détecte spécifiquement Mesothelin dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour Mesothelin anticorps (Middle Region) (ABIN634759)

Antigène: Mesothelin (MSLN)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Mesothelin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Mesothelin anticorps

Épitope: Middle Region

Specificité: Mesothelin antibody was raised against the middle region of MSLN

Purification: Affinity purified

Immunogène: Mesothelin antibody was raised using the middle region of MSLN corresponding to a region with amino acids LKALLEVNKGHEMSPQAPRRPLPQVATLIDRFVKGRGQLDKDTLDTLTAF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Mesothelin Blocking Peptide, (ABIN940459), is also available for use as a blocking control in assays to test for specificity of this Mesothelin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSLN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Mesothelin

Antigène: Mesothelin (MSLN)

Autre désignation: Mesothelin

Sujet: An antibody that reacts with ovarian cancers and mesotheliomas was used to isolate a cell surface antigen named mesothelin. Although the function of mesothelin is unknown, it may play a role in cellular adhesion and is present on mesothelium and mesothelioma.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Positive Regulation of Peptide Hormone Secretion, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Carbohydrate Homeostasis, cAMP Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling, Positive Regulation of Endopeptidase Activity, Regulation of Carbohydrate Metabolic Process