Glucagon anticorps (Middle Region)

N° du produit ABIN634780

Cet anticorps Lapin Polyclonal détecte spécifiquement Glucagon dans WB. Il présente une réactivité envers Humain, Rat et Souris.

Aperçu rapide pour Glucagon anticorps (Middle Region) (ABIN634780)

Antigène: Glucagon (GCG)

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Glucagon est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Glucagon anticorps

Épitope: Middle Region

Specificité: Glucagon antibody was raised against the middle region of GCG

Purification: Affinity purified

Immunogène: Glucagon antibody was raised using the middle region of GCG corresponding to a region with amino acids VSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Glucagon Blocking Peptide, (ABIN5613790), is also available for use as a blocking control in assays to test for specificity of this Glucagon antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Glucagon antibody is supplied as lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Glucagon

Antigène: Glucagon (GCG)

Autre désignation: Glucagon

Sujet: GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis.

Poids moléculaire: 4 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Peptide Hormone Metabolism, cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Negative Regulation of intrinsic apoptotic Signaling