Glucagon anticorps (Middle Region)
-
- Antigène Voir toutes Glucagon (GCG) Anticorps
- Glucagon (GCG)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Glucagon est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Glucagon antibody was raised against the middle region of GCG
- Purification
- Affinity purified
- Immunogène
- Glucagon antibody was raised using the middle region of GCG corresponding to a region with amino acids VSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMN
- Top Product
- Discover our top product GCG Anticorps primaire
-
anti-Glucagon (GCG) (AA 119-148), (C-Term) antibody
GCG Reactivité: Humain WB, IF, IHC (p), FACS Hôte: Lapin Polyclonal RB19525 unconjugated
anti-Glucagon (GCG) (AA 21-180) antibodyGCG Reactivité: Souris WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Glucagon (GCG) antibodyGCG Reactivité: Humain IHC, IF Hôte: Lapin Monoclonal unconjugated
anti-Glucagon (GCG) (AA 25-54), (N-Term) antibodyGCG Reactivité: Humain, Souris WB, IHC (p), FACS Hôte: Lapin Polyclonal RB19443 unconjugated
anti-Glucagon (GCG) (AA 1-180) antibodyGCG Reactivité: Humain ELISA, WB Hôte: Souris Monoclonal 1E2-E6 unconjugated
anti-Glucagon (GCG) antibodyGCG Reactivité: Humain, Rat, Souris ELISA, WB, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Glucagon (GCG) (AA 53-81), (N-Term) antibodyGCG Reactivité: Humain, Rat, Souris IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Glucagon (GCG) (AA 23-180) antibodyGCG Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Glucagon (GCG) (AA 53-81) antibodyGCG Reactivité: Humain, Rat, Souris ELISA, IHC (p), IF (cc), IF (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Glucagon (GCG) antibodyGCG Reactivité: Humain, Rat, Souris ELISA, IHC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Glucagon Blocking Peptide, catalog no. 33R-9829, is also available for use as a blocking control in assays to test for specificity of this Glucagon antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Glucagon antibody is supplied as lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Glucagon (GCG)
- Autre désignation
- Glucagon (GCG Produits)
- Synonymes
- anticorps GLP1, anticorps GLP2, anticorps GRPP, anticorps GLP-1, anticorps Glu, anticorps PPG, anticorps GCG, anticorps gcg-A, anticorps gcg1, anticorps glucagon, anticorps glucagon L homeolog, anticorps GCG, anticorps Gcg, anticorps gcg.L
- Sujet
- GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis.
- Poids moléculaire
- 4 kDa (MW of target protein)
- Pathways
- Positive Regulation of Peptide Hormone Secretion, Peptide Hormone Metabolism, cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Negative Regulation of intrinsic apoptotic Signaling
-
