Leptin anticorps (N-Term)

N° du produit ABIN634794

Cet anticorps anti-Leptin est un anticorps Lapin Polyclonal détectant Leptin dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour Leptin anticorps (N-Term) (ABIN634794)

Antigène: Leptin (LEP)

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Leptin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Leptin anticorps

Épitope: N-Term

Specificité: Leptin antibody was raised against the N terminal of LEP

Purification: Affinity purified

Immunogène: Leptin antibody was raised using the N terminal of LEP corresponding to a region with amino acids MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Leptin Blocking Peptide, (ABIN5614444), is also available for use as a blocking control in assays to test for specificity of this Leptin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Leptin

Antigène: Leptin (LEP)

Autre désignation: Leptin

Sujet: LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake.

Poids moléculaire: 16 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT, AMPK Signaling, Hormone Transport, Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Monocarboxylic Acid Catabolic Process