Leptin anticorps (N-Term)
-
- Antigène Voir toutes Leptin (LEP) Anticorps
- Leptin (LEP)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Leptin est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Leptin antibody was raised against the N terminal of LEP
- Purification
- Affinity purified
- Immunogène
- Leptin antibody was raised using the N terminal of LEP corresponding to a region with amino acids MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS
- Top Product
- Discover our top product LEP Anticorps primaire
-
anti-Leptin (LEP) (AA 22-167) antibody
LEP Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Leptin (LEP) (AA 22-167) antibodyLEP Reactivité: Rat WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Leptin (LEP) (AA 17-100) antibodyLEP Reactivité: Humain, Souris, Rat WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Leptin (LEP) (AA 8-37) antibodyLEP Reactivité: Humain WB, ELISA, IHC, IF, FACS Hôte: Lapin Polyclonal unconjugated
anti-Leptin (LEP) (AA 22-167) antibodyLEP Reactivité: Souris WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Leptin (LEP) (AA 29-160) antibodyLEP Reactivité: Boeuf (Vache) WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Leptin (LEP) antibodyLEP Reactivité: Humain, Souris, Rat IHC Hôte: Lapin Polyclonal unconjugated
anti-Leptin (LEP) (AA 22-167) antibodyLEP Reactivité: Humain WB, IF Hôte: Lapin Polyclonal unconjugated
anti-Leptin (LEP) (AA 7-37), (N-Term) antibodyLEP Reactivité: Humain WB, IF, FACS, EIA, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Leptin (LEP) (AA 22-167) antibodyLEP Reactivité: Humain WB, IHC, IP, ICC Hôte: Souris Monoclonal C5 unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Leptin Blocking Peptide, catalog no. 33R-6105, is also available for use as a blocking control in assays to test for specificity of this Leptin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Leptin (LEP)
- Autre désignation
- Leptin (LEP Produits)
- Synonymes
- anticorps ob, anticorps obese, anticorps LEPD, anticorps OB, anticorps OBS, anticorps leptin, anticorps Lep, anticorps LEP, anticorps lep
- Sujet
- LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake.
- Poids moléculaire
- 16 kDa (MW of target protein)
- Pathways
- Signalistation JAK/STAT, AMPK Signaling, Hormone Transport, Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Monocarboxylic Acid Catabolic Process
-
