LEFTY2 anticorps (N-Term)

N° du produit ABIN634801

Cet anticorps Lapin Polyclonal détecte spécifiquement LEFTY2 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour LEFTY2 anticorps (N-Term) (ABIN634801)

Antigène: LEFTY2 (Left-Right Determination Factor 2 (LEFTY2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LEFTY2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LEFTY2 anticorps

Épitope: N-Term

Specificité: LEFTY2 antibody was raised against the N terminal of LEFTY2

Purification: Affinity purified

Immunogène: LEFTY2 antibody was raised using the N terminal of LEFTY2 corresponding to a region with amino acids MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LEFTY2 Blocking Peptide, (ABIN5614439), is also available for use as a blocking control in assays to test for specificity of this LEFTY2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEFTY2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LEFTY2

Antigène: LEFTY2 (Left-Right Determination Factor 2 (LEFTY2))

Autre désignation: LEFTY2

Sujet: LEFTY2 is a member of the TGF-beta family of proteins. The protein is secreted and plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in its gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of its gene in the endometrium.

Poids moléculaire: 40 kDa (MW of target protein)